Loading...
Statistics
Advertisement

Fititech - Pitpro -
www.firitech.com/
PITPRO minimotot - kaikki tarvitsemasi löydät täältä!

Firitech.com

Advertisement
Conversion Technology Metas Server
Firitech.com is hosted in Finland / Lahti . Firitech.com uses HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: LiteSpeed.

Technologies in use by Firitech.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Iframe
  • Php

Advertisement

Server Type

  • LiteSpeed

Powered by

  • PHP/5.5.23

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Firitech.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=EssentialSSL Wildcard/CN=*.int2000.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: EssentialSSL Wildcard
      • CN: *.int2000.net
    • hash: 79c75474
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 244719659123865772196248019401187312185
    • validFrom: 140220000000Z
    • validTo: 170519235959Z
    • validFrom_time_t: 1392854400
    • validTo_time_t: 1495238399
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: EC:69:E3:60:1B:53:4C:20:E3:F3:02:F1:27:A8:9F:EF:01:A7:BD:79
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.int2000.net, DNS:int2000.net

Meta - Firitech.com

Number of occurences: 4
  • Name:
    Content: text/html; charset=ISO-8859-1
  • Name: MiniDirty - Pitpro -
    Content: www.minidirty.com, minidirty, mini, mx, 50.fi, fifty finland, fifty, minimopot, minicrossi, motocross, fmx, pitpro, pitpron jälleenmyyjä, pitpro, 125, pro, pro comp, standard, mini mx, minimoto, varusteet, varaosat, tarvikkeet, huolto, pitbike
  • Name: description
    Content: PITPRO minimotot - kaikki tarvitsemasi löydät täältä!
  • Name: verify-v1
    Content: Ile8JiL4KO6irNUDQ8/QGGAujVuxuiEQf+A9vSyaILY=

Server / Hosting

  • IP: 62.73.58.235
  • Latitude: 60.97
  • Longitude: 25.67
  • Country: Finland
  • City: Lahti

Rname

  • ns1.int2000.net
  • ns2.int2000.net
  • firitech.com

Target

  • jack.mymail.fi

HTTP Header Response

HTTP/1.1 302 Found X-Powered-By: PHP/5.5.23 Location: http://www.firitech.com/wb Content-Type: text/html Content-Length: 0 Date: Tue, 13 Sep 2016 04:06:55 GMT Accept-Ranges: bytes Server: LiteSpeed Cache-Control: no-cache, no-store, must-revalidate, max-age=0 X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 301 Moved Permanently Content-Type: text/html Content-Length: 1147 Date: Tue, 13 Sep 2016 04:06:55 GMT Accept-Ranges: bytes Server: LiteSpeed Location: http://www.firitech.com/wb/ X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK X-Powered-By: PHP/5.5.23 Set-Cookie: wb_session_id=18c0c5379fe25002c102f6c94fbef3c0; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Content-Type: text/html Content-Length: 3542 Date: Tue, 13 Sep 2016 04:06:58 GMT Accept-Ranges: bytes Server: LiteSpeed X-Cache: MISS from s_mf40 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

DNS

host: firitech.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 62.73.58.235
host: firitech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.int2000.net
host: firitech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.int2000.net
host: firitech.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.int2000.net
  5. rname: jack.mymail.fi
  6. serial: 2015072200
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: firitech.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: firitech.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.iritech.com, www.fqiritech.com, www.qiritech.com, www.firitech.com, www.iritech.com, www.fairitech.com, www.airitech.com, www.fyiritech.com, www.yiritech.com, www.ftiritech.com, www.tiritech.com, www.fgiritech.com, www.giritech.com, www.fbiritech.com, www.biritech.com, www.fwiritech.com, www.wiritech.com, www.fsiritech.com, www.siritech.com, www.fdiritech.com, www.diritech.com, www.friritech.com, www.riritech.com, www.f3iritech.com, www.3iritech.com, www.f4iritech.com, www.4iritech.com, www.fritech.com, www.firritech.com, www.frritech.com, www.fifritech.com, www.ffritech.com, www.fivritech.com, www.fvritech.com, www.fikritech.com, www.fkritech.com, www.fi,ritech.com, www.f,ritech.com, www.fibritech.com, www.fbritech.com, www.figritech.com, www.fgritech.com, www.fitritech.com, www.ftritech.com, www.fiyritech.com, www.fyritech.com, www.fiuritech.com, www.furitech.com, www.fijritech.com, www.fjritech.com, www.fimritech.com, www.fmritech.com, www.finritech.com, www.fnritech.com, www.fiitech.com, www.firiitech.com, www.fiiitech.com, www.firoitech.com, www.fioitech.com, www.firlitech.com, www.filitech.com, www.firlitech.com, www.filitech.com, www.fir.itech.com, www.fi.itech.com, www.firtech.com, www.firirtech.com, www.firrtech.com, www.firiftech.com, www.firftech.com, www.firivtech.com, www.firvtech.com, www.firiktech.com, www.firktech.com, www.firi,tech.com, www.fir,tech.com, www.firibtech.com, www.firbtech.com, www.firigtech.com, www.firgtech.com, www.firittech.com, www.firttech.com, www.firiytech.com, www.firytech.com, www.firiutech.com, www.firutech.com, www.firijtech.com, www.firjtech.com, www.firimtech.com, www.firmtech.com, www.firintech.com, www.firntech.com, www.firiech.com, www.firitqech.com, www.firiqech.com, www.firitaech.com, www.firiaech.com, www.firit ech.com, www.firi ech.com, www.firitwech.com, www.firiwech.com, www.firiteech.com, www.firieech.com, www.firitzech.com, www.firizech.com, www.firitxech.com, www.firixech.com, www.firitcech.com, www.firicech.com, www.firitch.com, www.firitexch.com, www.firitxch.com, www.firitesch.com, www.firitsch.com, www.firitewch.com, www.firitwch.com, www.firiterch.com, www.firitrch.com, www.firitefch.com, www.firitfch.com, www.firitevch.com, www.firitvch.com, www.firitecch.com, www.firitcch.com, www.firiteqch.com, www.firitqch.com, www.firiteach.com, www.firitach.com, www.firiteych.com, www.firitych.com, www.firiteh.com, www.firitecdh.com, www.firitedh.com, www.firitecrh.com, www.firiterh.com, www.firitecth.com, www.firiteth.com, www.firitecvh.com, www.firitevh.com, www.firitecfh.com, www.firitefh.com, www.firitecgh.com, www.firitegh.com, www.firitechh.com, www.firitehh.com, www.firitecnh.com, www.firitenh.com, www.firitecmh.com, www.firitemh.com, www.firitecjh.com, www.firitejh.com, www.firitec.com, www.firiteche.com, www.firitece.com, www.firitechd.com, www.firitecd.com, www.firitechc.com, www.firitecc.com, www.firitechu.com, www.firitecu.com, www.firitechj.com, www.firitecj.com, www.firitech.com, www.firitec.com, www.firitechb.com, www.firitecb.com, www.firitechg.com, www.firitecg.com,

Other websites we recently analyzed

  1. Mijn Talent
    Netherlands - 109.71.51.117
    Server software: Apache/2.4.18 (Unix) OpenSSL/1.0.1e-fips mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Google Font API, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  2. smallkitchenappliancesreviews.com
    Scottsdale (United States) - 184.168.221.104
    Server software: Microsoft-IIS/7.5
    Technology: Html
  3. Welcome to www.rolandkessel.nl
    www.rolandkessel.nl
    Netherlands - 83.96.159.15
    Server software: Apache/2
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 6
    Number of meta tags: 5
  4. performancecarsales.co.uk
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  5. Bible Sayings of the Fathers - sayings of moses, sayings of abraham, sayings of Isaach, sayings of Jacob
    Scottsdale (United States) - 23.229.188.67
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  6. © 2016 BAVUKISE
    coming soon template based on HTML5
    South Africa - 41.185.8.62
    Server software: Apache
    Technology: CSS, Google Font API, Html, Php, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 5
  7. weekend365 - Home
    weekend365 ordnance survey map-based gifts
    San Francisco (United States) - 199.34.228.100
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 3
  8. gulfdrug.net
    Road Town (Virgin Islands, British) - 208.91.197.132
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  9. 一般社団法人UIW | ベトナム人介護福祉士の教育・就労支援サービス
    ...
    Osaka (Japan) - 183.90.253.47
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, Carousel, CSS, Flexslider, Font Awesome, Html, Iframe, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3
  10. The White Eagle, Rhoscolyn, Anglesey
    Located by the sandy dunes of Rhosneigr, just a few seconds walk from the award winning Broad Beach (Traeth Llydan), The Oyster Catcher is the ultimate beachside destination.
    Maidenhead (United Kingdom) - 185.24.99.98
    G Analytics ID: UA-74202144-4
    Server software: Apache
    Technology: BootstrapCDN, Maxcdn, OSS CDN, AJAX Libraries API, CSS, Font Awesome, Google Font API, Html, Html5, Php, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 4

Check Other Websites